| Basic Information | |
|---|---|
| Taxon OID | 3300001357 Open in IMG/M |
| Scaffold ID | JGI11876J14442_10015051 Open in IMG/M |
| Source Dataset Name | Combined assembly of Elkhorn Slough mat metaG (MD2A, MD6A, CD2A, CD6A) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5188 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (12.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Elkhorn Slough, Monterey Bay, California, USA | |||||||
| Coordinates | Lat. (o) | 36.82188 | Long. (o) | -121.744 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015419 | Metagenome / Metatranscriptome | 255 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI11876J14442_100150512 | F015419 | N/A | MKYELKITDEQGNEHLYNVVRSSSDEPKNLNDFILEALSISEXKRXLPXLXQCPNGLEVHPSIKMKFKDYGSSLVGDKLEAMMVTWRCLVLK* |
| ⦗Top⦘ |