Scaffold JGI20158J14315_10087761

Overview

Basic Information

• Taxon OID: 3300001355
• Scaffold ID: JGI20158J14315_10087761
• Source Dataset Name: Pelagic Microbial community sample from North Sea - COGITO 998_met_08
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1113
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location

• Location Name: Helgoland, sampling site Kabeltonne
• Coordinates
  • Lat. (^o): 54.184167
  • Long. (^o): 7.9
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058282	Metagenome	135	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20158J14315_100877613	F058282	AGGAG	MAYDTSLPAGGPGNFVSPNTAHEADGVEVDFITVDYISAMNGEVTEPRAAANTGGLELSMQAIQNQGVNILGKGVLSNSNTEQTYMVRRDSLDTISSTTTVAAIQAAV