Scaffold JGI20151J14362_10005329

Overview

Basic Information

• Taxon OID: 3300001346
• Scaffold ID: JGI20151J14362_10005329
• Source Dataset Name: Pelagic Microbial community sample from North Sea - COGITO 998_met_01
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8354
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (55.56%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales → Mamiellaceae → Micromonas → Micromonas commoda (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location

• Location Name: Helgoland, sampling site Kabeltonne
• Coordinates
  • Lat. (^o): 54.184167
  • Long. (^o): 7.9
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062730	Metagenome / Metatranscriptome	130	N

Sequences

Protein ID	Family	RBS	Sequence
JGI20151J14362_100053299	F062730	GAG	MCDTYNMGNETPVGYRLVRVGVRGRVPTLHKRAPDDLTTRQKYDLRYREKHRAKLLSYHREYYKKKRSCSDR*