Scaffold JGI20133J14441_1057298

Overview

Basic Information

• Taxon OID: 3300001340
• Scaffold ID: JGI20133J14441_1057298
• Source Dataset Name: Ferric oxide microbial mat and aquatic microbial communities from Rainbow Spring, Yellowstone National Park, USA - RS3B
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 795
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.376
  • Long. (^o): -110.69

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053392	Metagenome / Metatranscriptome	141	N

Sequences

Protein ID	Family	RBS	Sequence
JGI20133J14441_10572981	F053392	GAGG	MSVPSYVTLTGPQTTVMPASFNIAASAAAGTVVQGSILAFGPQSPAVAAPQVPITEVWSIVDIYIIGSVTPDALLSVYINGYPQDINPDLNSLNLNNLTRWKLMQALKLPPASTWFTTVTLMGNNGTSQQTYTVYFSVIRAPYLPSSGK*