Scaffold ML7_10042112

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ML7_10042112

Scaffold ML7_10042112

Overview

Basic Information
Taxon OID	3300001336 Open in IMG/M
Scaffold ID	ML7_10042112 Open in IMG/M
Source Dataset Name	ML7
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Pennsylvania State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2309
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Benthic Lake → Benthic Lake Microbial Communities From British Columbia, Canada, For Chemocline Samples

Source Dataset Sampling Location
Location Name	Wetlands, British Columbia
Coordinates	Lat. (^o)	49.283333	Long. (^o)	-119.583333	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049659	Metagenome / Metatranscriptome	146	Y

Sequences

Protein ID	Family	RBS	Sequence
ML7_100421123	F049659	N/A	MISTYTVAEYTTEDTSVEVTYENSEGFIHKRNINIPHLEDGSIDEEYFQEILEGQLRGVNSKIRVGAISFTDPNAEVGIAST*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.