| Basic Information | |
|---|---|
| Taxon OID | 3300001336 Open in IMG/M |
| Scaffold ID | ML7_10007217 Open in IMG/M |
| Source Dataset Name | ML7 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Pennsylvania State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 10224 |
| Total Scaffold Genes | 19 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 16 (84.21%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Benthic Lake → Benthic Lake Microbial Communities From British Columbia, Canada, For Chemocline Samples |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Wetlands, British Columbia | |||||||
| Coordinates | Lat. (o) | 49.283333 | Long. (o) | -119.583333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012991 | Metagenome / Metatranscriptome | 275 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ML7_1000721713 | F012991 | AGGAG | MASYIYPKPGVANVELTLTLSVNGVQADTGMIVPSLQDVTVQADNDVFTWTQLDEGSKKQIATTATNSLSMNIVLDQDTFFGNTNATADTAEFKGIFGLSNDKTLVDFDLYFGDTSEGDEGKTLSGSGYVTGLSPTVSADSPVWVSPITITVDGDYTVA* |
| ⦗Top⦘ |