| Basic Information | |
|---|---|
| Taxon OID | 3300001335 Open in IMG/M |
| Scaffold ID | ML8_10175057 Open in IMG/M |
| Source Dataset Name | Wetlands benthic microbial communities from British Columbia, Canada - ML8 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 606 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Wetlands → Unclassified → Wetlands Benthic → Wetlands Benthic Microbial Communities From British Columbia, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | British Columbia, Canada | |||||||
| Coordinates | Lat. (o) | 49.283333 | Long. (o) | -119.583333 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F043420 | Metagenome / Metatranscriptome | 156 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ML8_101750572 | F043420 | GGAGG | MNKCICQIDGHKKSVTDAIIGFCEEMFEDKREVDPVSITGNAFSNNGLSFILKDGRNTYKVVYRNSMKVFEFFKESQI* |
| ⦗Top⦘ |