Scaffold ML8_10082777

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ML8_10082777

Scaffold ML8_10082777

Overview

Basic Information
Taxon OID	3300001335 Open in IMG/M
Scaffold ID	ML8_10082777 Open in IMG/M
Source Dataset Name	Wetlands benthic microbial communities from British Columbia, Canada - ML8
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1077
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Unclassified → Wetlands Benthic → Wetlands Benthic Microbial Communities From British Columbia, Canada

Source Dataset Sampling Location
Location Name	British Columbia, Canada
Coordinates	Lat. (^o)	49.283333	Long. (^o)	-119.583333	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053262	Metagenome / Metatranscriptome	141	Y

Sequences

Protein ID	Family	RBS	Sequence
ML8_100827774	F053262	GAG	MTELTQEQRQTIEDALNSIPESVRTGMYGTMEGIEEQLARGDKIIFYMKPNELGGFNIDKMKVGEE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.