Basic Information | |
---|---|
Taxon OID | 3300001325 Open in IMG/M |
Scaffold ID | LCLOrf001_1010712 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Red Sea - Atlantis II brine metagenomic assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 952 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Red Sea | |||||||
Coordinates | Lat. (o) | 21.351508 | Long. (o) | 38.078207 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F052244 | Metagenome | 143 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LCLOrf001_10107121 | F052244 | N/A | KEKLRTEIYLLLLTLALSLVVAIITFYIVAGTWARIDRGLNLIDNMLACIKGCPP* |
⦗Top⦘ |