Scaffold LCLOrf001_1007105

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LCLOrf001_1007105

Scaffold LCLOrf001_1007105

Overview

Basic Information
Taxon OID	3300001325 Open in IMG/M
Scaffold ID	LCLOrf001_1007105 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Red Sea - Atlantis II brine metagenomic assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1331
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea

Source Dataset Sampling Location
Location Name	Red Sea
Coordinates	Lat. (^o)	21.351508	Long. (^o)	38.078207	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068204	Metagenome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
LCLOrf001_10071052	F068204	AGAAGG	VRLAYKILIGLGIAFVVLFGVPATYAAATGKSEALKGLIQTLKYILKAHVETLKAMVNAYTKFLGSL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.