NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LCLOrf001_1004131

Scaffold LCLOrf001_1004131


Overview

Basic Information
Taxon OID3300001325 Open in IMG/M
Scaffold IDLCLOrf001_1004131 Open in IMG/M
Source Dataset NameMarine microbial communities from the Red Sea - Atlantis II brine metagenomic assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1937
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (77.78%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea

Source Dataset Sampling Location
Location NameRed Sea
CoordinatesLat. (o)21.351508Long. (o)38.078207Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F052244Metagenome143Y

Sequences

Protein IDFamilyRBSSequence
LCLOrf001_10041312F052244GGAGGMTNSMKDRLRTEIYLLLLTLALSLVVGIITFYIVAGTWARIDRGLDQIDDMIACMKGCPP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.