Basic Information | |
---|---|
Taxon OID | 3300001325 Open in IMG/M |
Scaffold ID | LCLOrf001_1002187 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Red Sea - Atlantis II brine metagenomic assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2992 |
Total Scaffold Genes | 9 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Red Sea | |||||||
Coordinates | Lat. (o) | 21.351508 | Long. (o) | 38.078207 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F106033 | Metagenome | 100 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
LCLOrf001_10021877 | F106033 | AGGAGG | MVSWGNLADRLEQWASSKYALLECNMDPDHDDVEIAGNPDFVHHDSGEQFSWDGWTSVVFITDLRHDGDFGLKLKSTDNDIIPFRARGDTAERILPEVTAIYFNNTGTSGTNYLLLEGY* |
⦗Top⦘ |