Scaffold LCLOrf001_1000502

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold LCLOrf001_1000502

Scaffold LCLOrf001_1000502

Overview

Basic Information
Taxon OID	3300001325 Open in IMG/M
Scaffold ID	LCLOrf001_1000502 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Red Sea - Atlantis II brine metagenomic assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8870
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea

Source Dataset Sampling Location
Location Name	Red Sea
Coordinates	Lat. (^o)	21.351508	Long. (^o)	38.078207	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F106033	Metagenome	100	N

Sequences

Protein ID	Family	RBS	Sequence
LCLOrf001_100050214	F106033	GGAGG	MVEPHDEAVREKALREWASSKYALLECNMDPDHDDVEIAGNPDFVHHDSGEQFSWDDWTSVVFITDLRHDGDFGLKLKSTDNDVIPFRRRGDRAERILSEVTAIYFNNTGTAGTNYLLLEGY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.