Scaffold C688J14111_10060955

Overview

Basic Information

• Taxon OID: 3300001305
• Scaffold ID: C688J14111_10060955
• Source Dataset Name: Grasslands soil microbial communities from Hopland, California, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1143
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Mediterranean Grasslands, California

Source Dataset Sampling Location

• Location Name: USA: Hopland, California
• Coordinates
  • Lat. (^o): 38.99297339
  • Long. (^o): -123.0674491

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066182	Metagenome / Metatranscriptome	127	N

Sequences

Protein ID	Family	RBS	Sequence
C688J14111_100609552	F066182	N/A	VTLGTPVCMSSVDHAAELVGGYEALGQRLGVRTEQVMDWSLGLVSPNTATLLFVLDVIMQETEKLSRAAVAFELAGQVLAKARRSSKAT*