Scaffold Bac131567_1194058

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Bac131567_1194058

Scaffold Bac131567_1194058

Overview

Basic Information
Taxon OID	3300001298 Open in IMG/M
Scaffold ID	Bac131567_1194058 Open in IMG/M
Source Dataset Name	Permafrost soil microbial communities from Miers Valley, Antarctica - Ant1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	35414
Total Scaffold Genes	50 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	26 (52.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost Soil → Permafrost Soil Microbial Communities From Miers Valley, Antarctica

Source Dataset Sampling Location
Location Name	Lake Miers, Antarctica
Coordinates	Lat. (^o)	-78.099535	Long. (^o)	163.850256	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051905	Metagenome	143	N

Sequences

Protein ID	Family	RBS	Sequence
Bac131567_119405828	F051905	N/A	MSFRNDETIISSISVTDIVFDVYLGKWNYRAILKVKTWSYFLTIP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.