| Basic Information | |
|---|---|
| Taxon OID | 3300001298 Open in IMG/M |
| Scaffold ID | Bac131567_1046072 Open in IMG/M |
| Source Dataset Name | Permafrost soil microbial communities from Miers Valley, Antarctica - Ant1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4267 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost Soil → Permafrost Soil Microbial Communities From Miers Valley, Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Miers, Antarctica | |||||||
| Coordinates | Lat. (o) | -78.099535 | Long. (o) | 163.850256 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051905 | Metagenome | 143 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Bac131567_10460722 | F051905 | N/A | MNDETIISSISVTDIVFDVYLGKWNYRAIPKAKTWSYFLTIP* |
| ⦗Top⦘ |