Scaffold B570J13895_1003181

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold B570J13895_1003181

Scaffold B570J13895_1003181

Overview

Basic Information
Taxon OID	3300001274 Open in IMG/M
Scaffold ID	B570J13895_1003181 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2067
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location Name	Lake Mendota, Madison, WI
Coordinates	Lat. (^o)	43.098333	Long. (^o)	-89.405278	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076095	Metagenome	118	N

Sequences

Protein ID	Family	RBS	Sequence
B570J13895_10031813	F076095	N/A	YRYMKYLKSFNESIENQIYQQVLDSIKDCFQEFEDNGWHWISDVSYGSGISVWQNPNFNCRMMNKEESDPRNWTLNKNPYEKNIDITGEIKSDGSINWEMNEDETDSEDGKDFLVAVKRLHDETGLDFRFSYNNRGGERRIIIQGRI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.