NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B570J13886_101321

Scaffold B570J13886_101321


Overview

Basic Information
Taxon OID3300001272 Open in IMG/M
Scaffold IDB570J13886_101321 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1671
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033356Metagenome / Metatranscriptome177Y
F048763Metagenome / Metatranscriptome147N
F050791Metagenome / Metatranscriptome145Y

Sequences

Protein IDFamilyRBSSequence
B570J13886_1013213F050791N/AMTKTRSTTAKQNNKPTTKSTEIKTIVIPKHLIELITFLHEANKIQFDLTKTLLDRMKDDNSTNQ*
B570J13886_1013214F033356N/AMTTQLTNNSSINPLQDDILPQEDQRPKTHLQLQYITQTNRLPFTEAHQEQYSANVTINPFKLLELHNKLIVIEGQLSHLTDKVAAIVVEIHKMTHQN*
B570J13886_1013215F048763N/AMNYPPSQPISTFLQQRPPPTTQTDCFFTYTRISSQCKPVDRIADSIDPFELANNTNQIPSSNIAQDVHHSVNTLYDIQKSIFSSLTPTQTTLFTTYHNLLVSISRYLSQSENIPQP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.