Scaffold BBAY90_17930202

Overview

Basic Information

• Taxon OID: 3300001271
• Scaffold ID: BBAY90_17930202
• Source Dataset Name: Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY90
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 608
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → Saprospiraceae → unclassified Saprospiraceae → Saprospiraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Source Dataset Sampling Location

• Location Name: Botany Bay, Sydney, NSW, Australia
• Coordinates
  • Lat. (^o): -33.966629
  • Long. (^o): 151.166614

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028441	Metagenome / Metatranscriptome	191	Y

Sequences

Protein ID	Family	RBS	Sequence
BBAY90_179302022	F028441	N/A	VWVVSPTLHYDVDNKDFSELVSVNLGEKTKYRYIVPATSAVIKNITAYKKMYGVTEADIENNFLILPTSEFNPFITETAIYDASTSCIACAAPALEDSNDVIKFNEETSKGMAKAFKSLWKKYKRKNP*