Scaffold B570J13877_101585

Overview

Basic Information

• Taxon OID: 3300001268
• Scaffold ID: B570J13877_101585
• Source Dataset Name: Freshwater microbial communities from Lake Mendota, WI - 12SEP2008 deep hole epilimnion
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 943
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location

• Location Name: Lake Mendota, Madison, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.099444
  • Long. (^o): -89.404444

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067680	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
B570J13877_1015851	F067680	N/A	TIQTITGSCLHIEIDGEEGTTHATFVFKTPSIPDTLGNFIKMLAMGIEVLVPIENPEDEEEDDD*