Scaffold JGIcombinedJ13530_108639646

Overview

Basic Information

• Taxon OID: 3300001213
• Scaffold ID: JGIcombinedJ13530_108639646
• Source Dataset Name: Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Draft

Scaffold Components

• Scaffold Length (bps): 565
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → unclassified Geodermatophilaceae → Geodermatophilaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Wetland Microbial Communities From Twitchell Island In The Sacramento Delta

Source Dataset Sampling Location

• Location Name: Twitchell Island in the Sacramento/San Joaquin Delta, CA
• Coordinates
  • Lat. (^o): 38.107057
  • Long. (^o): -121.647578
  • Depth (m): 0 to .12

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006349	Metagenome / Metatranscriptome	375	Y

Sequences

Protein ID	Family	RBS	Sequence
JGIcombinedJ13530_1086396461	F006349	N/A	DRPWHDIAPDGNGPETRAHPSCVLKADVHGFGSLMRAGADAPVRKALVDAVARWAPPAAIGETGAGDSVLIADDDAVALAQTARHLMDEVYTAPGQPLLRIALHHGEVRTRRRDLKPGSDIVGGDAILCAARVEPFVTPGQIWMTEEFREQFLQRPSLWRTVPIATPSGGDRFNVHKEATGEPDLWVR