| Basic Information | |
|---|---|
| Taxon OID | 3300001213 Open in IMG/M |
| Scaffold ID | JGIcombinedJ13530_106970095 Open in IMG/M |
| Source Dataset Name | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 785 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Wetland Microbial Communities From Twitchell Island In The Sacramento Delta |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Twitchell Island in the Sacramento/San Joaquin Delta, CA | |||||||
| Coordinates | Lat. (o) | 38.107057 | Long. (o) | -121.647578 | Alt. (m) | Depth (m) | 0 to .12 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F046458 | Metagenome / Metatranscriptome | 151 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGIcombinedJ13530_1069700951 | F046458 | GGGGG | MRMRLQRAVGVAVAVAAVSSLPGCGGDSPRPPVVVITPEPVRGVIAQASLSGFQSGVWISIDLLLSQRGKLDITVDWTVPDTWMYVYLGRTKCDYAQLSGGTCPFILASETKNPKPRVLFSEELDPATYYLVLYNVPRDPRTGIGSDNTESIAIQLGLTVSANG |
| ⦗Top⦘ |