Basic Information | |
---|---|
Taxon OID | 3300001213 Open in IMG/M |
Scaffold ID | JGIcombinedJ13530_103776624 Open in IMG/M |
Source Dataset Name | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3389 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Wetland Microbial Communities From Twitchell Island In The Sacramento Delta |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Twitchell Island in the Sacramento/San Joaquin Delta, CA | |||||||
Coordinates | Lat. (o) | 38.107057 | Long. (o) | -121.647578 | Alt. (m) | Depth (m) | 0 to .12 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042655 | Metagenome | 158 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGIcombinedJ13530_1037766241 | F042655 | GGAG | LKMFELTIPPEYLTYINGEIKKPKRQNTELIELWLERELKIENPSSYGNLPIDESHVTIRVLPKGSFKMDISETCFNMIVSHVQPEPHSHRMTNEDVLHCWLDMKTNKAHLKQHIGVKEKIKQ* |
⦗Top⦘ |