Basic Information | |
---|---|
Taxon OID | 3300001199 Open in IMG/M |
Scaffold ID | J055_10337180 Open in IMG/M |
Source Dataset Name | Lotic microbial communities from nuclear landfill site in Hanford, Washington, USA - IFRC combined assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Pacific Northwest National Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 520 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic → Lotic Microbial Communities From Nuclear Landfill Site In Hanford, Washington, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hanford, Washington, USA | |||||||
Coordinates | Lat. (o) | 46.371184 | Long. (o) | -119.275414 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F105129 | Metagenome / Metatranscriptome | 100 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
J055_103371801 | F105129 | GGCGG | MTIKSPLSGCGVSRRDMLRIGASGLGLGLYGGLGPVPYVLAQASRASAAATSGR |
⦗Top⦘ |