Scaffold J055_10039963

Overview

Basic Information

• Taxon OID: 3300001199
• Scaffold ID: J055_10039963
• Source Dataset Name: Lotic microbial communities from nuclear landfill site in Hanford, Washington, USA - IFRC combined assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Pacific Northwest National Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2096
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic → Lotic Microbial Communities From Nuclear Landfill Site In Hanford, Washington, Usa

Source Dataset Sampling Location

• Location Name: Hanford, Washington, USA
• Coordinates
  • Lat. (^o): 46.371184
  • Long. (^o): -119.275414

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087621	Metagenome / Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
J055_100399631	F087621	GAG	MNGRKREGTVEILRGRRRLRRRKRTYKAQAEVVRDAAWEVGRGHSVAMKAWTAKPARAKGLDSSRAFEEGRTV*