| Basic Information | |
|---|---|
| Taxon OID | 3300001136 Open in IMG/M |
| Scaffold ID | JGI1684J13235_1056678 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial community from Fremont, CA, USA - Pond A23 Sediment 2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 591 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alviso Ponds, San Francisco, CA, USA | |||||||
| Coordinates | Lat. (o) | 37.474067 | Long. (o) | -121.973033 | Alt. (m) | Depth (m) | .075 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F087432 | Metagenome | 110 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI1684J13235_10566782 | F087432 | GAGG | MIIYEDGXYTPCTYKVILKNNGKEETHYANFRTYWEDMVAKHDHLTDLAFEEITFTPEQDTRLQEIAELEIPQGFQSEVRQYVEAGEFPEGYQHPLADLKQKKEKEKYD |
| ⦗Top⦘ |