Scaffold JGI1684J13235_1056678

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI1684J13235_1056678

Scaffold JGI1684J13235_1056678

Overview

Basic Information
Taxon OID	3300001136 Open in IMG/M
Scaffold ID	JGI1684J13235_1056678 Open in IMG/M
Source Dataset Name	Marine sediment microbial community from Fremont, CA, USA - Pond A23 Sediment 2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	591
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico

Source Dataset Sampling Location
Location Name	Alviso Ponds, San Francisco, CA, USA
Coordinates	Lat. (^o)	37.474067	Long. (^o)	-121.973033	Alt. (m)		Depth (m)	.075
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087432	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI1684J13235_10566782	F087432	GAGG	MIIYEDGXYTPCTYKVILKNNGKEETHYANFRTYWEDMVAKHDHLTDLAFEEITFTPEQDTRLQEIAELEIPQGFQSEVRQYVEAGEFPEGYQHPLADLKQKKEKEKYD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.