Scaffold JGI12137J13328_104911

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI12137J13328_104911

Scaffold JGI12137J13328_104911

Overview

Basic Information
Taxon OID	3300001120 Open in IMG/M
Scaffold ID	JGI12137J13328_104911 Open in IMG/M
Source Dataset Name	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	500
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location Name	El Dorado National Forest, Georgetown, California, USA
Coordinates	Lat. (^o)	38.88	Long. (^o)	-120.64	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064046	Metagenome / Metatranscriptome	129	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12137J13328_1049111	F064046	N/A	PHDGGAAHTGAGVRKPPMEETAGGVVKWRVRRYRDLTAVVPECEHNFCDMARTLRMGENTFRRPCNFKELRVVKRAHITTCALCA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.