| Basic Information | |
|---|---|
| Taxon OID | 3300001097 Open in IMG/M |
| Scaffold ID | JGIcombinedJ13537_10067988 Open in IMG/M |
| Source Dataset Name | Saline microbial communities from Lake Vida, Antarctica (Lake Vida Brine Hole Two - Combined Assembly 2 samples, Mar 2013 Assem) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 846 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Phasmatodea → Verophasmatodea → Areolatae → Bacilloidea → Bacillidae → Bacillinae → Bacillini → Bacillus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Lake Vida, Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Vida, Antarctica | |||||||
| Coordinates | Lat. (o) | -77.38861 | Long. (o) | 161.931111 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F070641 | Metagenome | 123 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGIcombinedJ13537_100679881 | F070641 | N/A | GTKALSDFTHIECGQVFQSLQMHRKTLRYMDKLLFDITFIKLARKKDLDSFRSLEFDGMEMRTMSEALRFRGQNLIKHKNYLASVKYFELAQEIEGKMFRFQQGNKPEVGLKMEMSV* |
| ⦗Top⦘ |