Scaffold JGI12648J13191_1000093

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI12648J13191_1000093

Scaffold JGI12648J13191_1000093

Overview

Basic Information
Taxon OID	3300001084 Open in IMG/M
Scaffold ID	JGI12648J13191_1000093 Open in IMG/M
Source Dataset Name	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11950
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (70.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location Name	Thunder Bay, Ontario, Canada
Coordinates	Lat. (^o)	49.08	Long. (^o)	-89.38	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021586	Metagenome / Metatranscriptome	218	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12648J13191_10000936	F021586	GGAGG	MGTMTAQLSSETHNTVTEELISARRLWTAVLLNAVEDWRNGTLRAKREAQEFLFDSGEDFDMVCTAAGLDSGDFRVRLLKLGRRVEMRTPFSLCFAT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.