Scaffold JGI12026J13078_1000105

Overview

Basic Information

• Taxon OID: 3300000961
• Scaffold ID: JGI12026J13078_1000105
• Source Dataset Name: Marine microbial communities from the Deep Pacific Ocean - MP1649
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7335
• Total Scaffold Genes: 15
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (26.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: North of Tokelau, South Pacific Ocean
• Coordinates
  • Lat. (^o): -5.74
  • Long. (^o): -170.77
  • Depth (m): 4017.73

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012125	Metagenome	283	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12026J13078_100010510	F012125	N/A	MSDTRYSVMHPDGGKYSFFSAGKPKNLPRFYFLVLAGIFLMIFMFLWFD*