| Basic Information | |
|---|---|
| Taxon OID | 3300000956 Open in IMG/M |
| Scaffold ID | JGI10216J12902_111592129 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1346 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Kansas, USA | |||||||
| Coordinates | Lat. (o) | 39.214012 | Long. (o) | -96.585283 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033565 | Metagenome / Metatranscriptome | 177 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI10216J12902_1115921291 | F033565 | N/A | QQNKLVSEPPIAAPDEQAQLVEADQRFRAALDVAIATGAERIEAVEATVQLKRGRTKVPR |
| ⦗Top⦘ |