NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI10216J12902_109223183

Scaffold JGI10216J12902_109223183


Overview

Basic Information
Taxon OID3300000956 Open in IMG/M
Scaffold IDJGI10216J12902_109223183 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Kansas, Native Prairie soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2713
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameKansas, USA
CoordinatesLat. (o)39.214012Long. (o)-96.585283Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003871Metagenome / Metatranscriptome464Y
F009698Metagenome / Metatranscriptome314Y

Sequences

Protein IDFamilyRBSSequence
JGI10216J12902_1092231831F003871AGGAGMAWYEIINAKSDSFVADRDAEDLLRHLATALQTEDGPVEAEVFYGLTSNGARRYYLSLSPEAVELAERVLATYDARELMAPPDLTGM
JGI10216J12902_1092231832F009698GAGMAFLDDAEATTYHMLKQVLQNHCATQTLCFPHTLVACGALVALVCAQLNETRSALEPVVAHTLVDLKRYTRARRTAPPLAPFPVECLTHDTPAHLAQSEAVFQALAQFLHDSLAAERVTLAGAIRIVLSLLADLFAMLTHQYGHTAEEVEARIDRLRSPLRSQITAYHRQRDEGG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.