NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI10216J12902_106402566

Scaffold JGI10216J12902_106402566


Overview

Basic Information
Taxon OID3300000956 Open in IMG/M
Scaffold IDJGI10216J12902_106402566 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Kansas, Native Prairie soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2957
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameKansas, USA
CoordinatesLat. (o)39.214012Long. (o)-96.585283Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F087647Metagenome / Metatranscriptome110N

Sequences

Protein IDFamilyRBSSequence
JGI10216J12902_1064025664F087647N/AMDPVSTHAALQIAFVAADNLGAALTEKLRAIRASGAAPLSLEQHLLLERAYAVLREYCFYYGALMPAFGSGLVSFTARQALLVCVRGLYVELAELQRIKIELQGEAGIDVQAYFASPLSEWIEALNTEAPQYAVEPLLLPQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.