Scaffold JGI10216J12902_105574450

Overview

Basic Information

• Taxon OID: 3300000956
• Scaffold ID: JGI10216J12902_105574450
• Source Dataset Name: Soil microbial communities from Great Prairies - Kansas, Native Prairie soil
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2091
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location

• Location Name: Kansas, USA
• Coordinates
  • Lat. (^o): 39.214012
  • Long. (^o): -96.585283

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057507	Metagenome / Metatranscriptome	136	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI10216J12902_1055744504	F057507	AGGAG	MLDSRKRYLLQEQNRQASLVACMPFDCHTQRLGRMTPSTPTVTIHSPAVQQPVVLTHLTAFLLRARHAFLQTFHSAEHSDIDIFDQHQQLLVRCTIREAETDRRMPAPSISPAQEALPENLVTLIHALVQACTVTAEYQQ*