NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI1027J12803_101448250

Scaffold JGI1027J12803_101448250


Overview

Basic Information
Taxon OID3300000955 Open in IMG/M
Scaffold IDJGI1027J12803_101448250 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Iowa, Native Prairie soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)943
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameUSA: Maryland: National Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032940Metagenome / Metatranscriptome178Y

Sequences

Protein IDFamilyRBSSequence
JGI1027J12803_1014482501F032940GAGMKMKQIISFALVSIVALAASVATLRADPQNSATPEQKKVTYVRKYVKVTGSNIPVPVWVAEGPLPKTTYPIRSYSSDEISKIPGATTPAQVL
JGI1027J12803_1014482503F032940N/ASLIMNLKSFISVGCVFLRLALVPIVALAASVATVSADPQRVTYVKKYVRVTGSNIPVPVWVAAGPLPQTTYPLRSYDYNEITKIPGAYTPAQVLANDPSITIRGGGY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.