| Basic Information | |
|---|---|
| Taxon OID | 3300000949 Open in IMG/M |
| Scaffold ID | BBAY94_10168747 Open in IMG/M |
| Source Dataset Name | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 592 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Botany Bay, Sydney, NSW, Australia | |||||||
| Coordinates | Lat. (o) | -33.966629 | Long. (o) | 151.166614 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F034342 | Metagenome / Metatranscriptome | 175 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BBAY94_101687472 | F034342 | AGG | MSDKSFKTPKNRALGASLAHKFTPGDIVSWKSWAINLESEVFEDKEGLLLEILEENRLENIVLIAKIMPFGASEYEFIPLFSLKKSKKQD* |
| ⦗Top⦘ |