Scaffold BBAY92_10172381

Overview

Basic Information

• Taxon OID: 3300000947
• Scaffold ID: BBAY92_10172381
• Source Dataset Name: Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 565
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Source Dataset Sampling Location

• Location Name: Botany Bay, Sydney, NSW, Australia
• Coordinates
  • Lat. (^o): -33.966629
  • Long. (^o): 151.166614

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048246	Metagenome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
BBAY92_101723812	F048246	AGGAG	MVLPEDSNNAIVDALNRINESLEENNQVLNRILNHYDSVVPVMKKNQEAVASANEDNRSTLDMMYDKVFNN*