Scaffold BBAY92_10000787

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BBAY92_10000787

Scaffold BBAY92_10000787

Overview

Basic Information
Taxon OID	3300000947 Open in IMG/M
Scaffold ID	BBAY92_10000787 Open in IMG/M
Source Dataset Name	Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7767
Total Scaffold Genes	20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (35.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Source Dataset Sampling Location
Location Name	Botany Bay, Sydney, NSW, Australia
Coordinates	Lat. (^o)	-33.966629	Long. (^o)	151.166614	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017299	Metagenome / Metatranscriptome	241	Y

Sequences

Protein ID	Family	RBS	Sequence
BBAY92_1000078712	F017299	GAG	MNNKIEPLKITVKFYNKKITTEVDHSDLPLDELHDLWIDMLRAMGYHENTIKEYYE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.