Scaffold BpDRAFT_10595610

Overview

Basic Information

• Taxon OID: 3300000930
• Scaffold ID: BpDRAFT_10595610
• Source Dataset Name: Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Maryland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 509
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location

• Location Name: Columbia River plume, coastal ocean
• Coordinates
  • Lat. (^o): 46.233
  • Long. (^o): -124.16
  • Depth (m): 16

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043092	Metagenome	157	Y

Sequences

Protein ID	Family	RBS	Sequence
BpDRAFT_105956101	F043092	N/A	MIRLKNILLELKDEDIQRLLSKINNNEYRFFDQGDNGRVYEIDGEDKLFKITNESDEFDVATVIVGRASEFSTFIPIYYVDDVKQLYIMSKASSLNNNDVNNIDLFMNSYKEYAREIGGEASVFDYINADGARDVDPELISFLRALQRDINKMGIMDLD