Scaffold NpDRAFT_10052498

Overview

Basic Information

• Taxon OID: 3300000929
• Scaffold ID: NpDRAFT_10052498
• Source Dataset Name: Marine plume microbial communities from the Columbia River - 15 PSU
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Maryland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1408
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location

• Location Name: Columbia River plume, coastal ocean
• Coordinates
  • Lat. (^o): 46.239
  • Long. (^o): -124.161
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007226	Metagenome / Metatranscriptome	355	Y

Sequences

Protein ID	Family	RBS	Sequence
NpDRAFT_100524981	F007226	GAGG	MQNLLNRITYYFLNRAYTQLEATGELQNADDAAEFLEDYFAQLVK*