Scaffold OpTDRAFT_10238309

Overview

Basic Information

• Taxon OID: 3300000928
• Scaffold ID: OpTDRAFT_10238309
• Source Dataset Name: Marine plume microbial communities from the Columbia River - 25 PSU
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Maryland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 504
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location

• Location Name: Columbia River plume, coastal ocean
• Coordinates
  • Lat. (^o): 46.233
  • Long. (^o): -124.16
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018009	Metagenome / Metatranscriptome	237	Y

Sequences

Protein ID	Family	RBS	Sequence
OpTDRAFT_102383091	F018009	N/A	DFTGYSDSYAIPASSTDVIFSGSVDLILSTGITQQVFDSLSSALKCIHYMEANKLYSLSPNEDVTVLNLRSKLLILENTYINQKMMNSYVFTYHGNQVQAIHRSMADMVSLSEALASVGFRCVGLPWSTAVNPKMETDRADKDRPRIQVVDYLYKSPNLPHTNLIDA