Basic Information | |
---|---|
Taxon OID | 3300000928 Open in IMG/M |
Scaffold ID | OpTDRAFT_10124177 Open in IMG/M |
Source Dataset Name | Marine plume microbial communities from the Columbia River - 25 PSU |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Maryland |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 864 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Columbia River plume, coastal ocean | |||||||
Coordinates | Lat. (o) | 46.233 | Long. (o) | -124.16 | Alt. (m) | Depth (m) | 1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F058065 | Metagenome / Metatranscriptome | 135 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
OpTDRAFT_101241772 | F058065 | GGA | MTTLYRIYDHTDKNILANAIPEYDHAYTVLGYLKLDLPNNELEIESYTQSPVRKGFGRDPDLH* |
⦗Top⦘ |