| Basic Information | |
|---|---|
| Taxon OID | 3300000928 Open in IMG/M |
| Scaffold ID | OpTDRAFT_10084841 Open in IMG/M |
| Source Dataset Name | Marine plume microbial communities from the Columbia River - 25 PSU |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Maryland |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2344 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Columbia River plume, coastal ocean | |||||||
| Coordinates | Lat. (o) | 46.233 | Long. (o) | -124.16 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F066806 | Metagenome / Metatranscriptome | 126 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| OpTDRAFT_100848414 | F066806 | AGGA | MSMEVYEKIGENLNSIVKIKNYQVAPLYPKGKPGTNDKSVREFRLQLINKDNDTSKELIDHLKMQLRKDTSLKSVTFNTISPNSSKFPSYSFTFDGLNFDIIIARGANAGEKFEVRTVKTLDNYFKTRTDNETSEVVTMMSESHAPFANAEIVGAVQRTGATKKEGIPIDKLGAIIGDIILTDNQGNPWYISLKDINGNTFSSYSGAASLFDREGNLQPNSAGATFLKTFGVDLNKVQAGFDERGSINKVRPKLAVPRANAREIEKIFNRAWGMNYFYVRRMRTGWKVFWLGKTKLDKLSQNIKIDDIRYPSTKSKQITILCSNTVEDYVIELRNSKAGEYPNDTKFKVKK* |
| ⦗Top⦘ |