NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold WSSedA2C3DRAFT_1023398

Scaffold WSSedA2C3DRAFT_1023398


Overview

Basic Information
Taxon OID3300000917 Open in IMG/M
Scaffold IDWSSedA2C3DRAFT_1023398 Open in IMG/M
Source Dataset NameWetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A2 Cattail
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)881
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Wetland Microbial Communities From Twitchell Island In The Sacramento Delta

Source Dataset Sampling Location
Location NameTwitchell Island in the Sacramento/San Joaquin Delta, CA
CoordinatesLat. (o)38.107057Long. (o)-121.647578Alt. (m)Depth (m)0 to .12
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045705Metagenome / Metatranscriptome152Y

Sequences

Protein IDFamilyRBSSequence
WSSedA2C3DRAFT_10233983F045705N/AMEIDVTQLQMGDEFLYSVQGNIVRAKVIRPVEPKKVQPNYGTVGKTFYKSVKCKVAMKETSYTTNWNGNLRTWTRKEYCASDNYTVEKFVDLNYRNIWLIKRED*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.