NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI10214J12806_11707399

Scaffold JGI10214J12806_11707399


Overview

Basic Information
Taxon OID3300000891 Open in IMG/M
Scaffold IDJGI10214J12806_11707399 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Wisconsin, Continuous corn soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)559
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameIowa, USA
CoordinatesLat. (o)43.303333Long. (o)-89.334167Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F052125Metagenome / Metatranscriptome143Y

Sequences

Protein IDFamilyRBSSequence
JGI10214J12806_117073991F052125N/AAYAIEMTECDPGVRMLSFFHLVDETDLDRWQSGLERADGSHRPSYDRVKQTIAQTHGTCQGTPTRWKHTTGVVLPAAAWGKLSKPFPARRLRLKFVAGAGEGADFRAGVFKAGPRKAVLGKRLAKGRPKPALFAKGSIKATRRVVYFPARRLKRGTYVFAIRMTAQMNSKRATVLVSRRFRVGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.