| Basic Information | |
|---|---|
| Taxon OID | 3300000887 Open in IMG/M |
| Scaffold ID | AL16A1W_10022759 Open in IMG/M |
| Source Dataset Name | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Tennessee |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5861 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Axel Heiberg Island, Nunavut, Canada | |||||||
| Coordinates | Lat. (o) | 79.26 | Long. (o) | -90.46 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004189 | Metagenome / Metatranscriptome | 449 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| AL16A1W_100227591 | F004189 | GGAGG | MRRFSDRSGIDWSAFETARPGGLPDRRVKAANVTVSFKCDDGSEVAMDLPVGALEGLTDEELILL |
| ⦗Top⦘ |