NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold EsDRAFT_10093416

Scaffold EsDRAFT_10093416


Overview

Basic Information
Taxon OID3300000883 Open in IMG/M
Scaffold IDEsDRAFT_10093416 Open in IMG/M
Source Dataset NameEstuary microbial communities from the Columbia River - 5 PSU
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Maryland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2283
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (16.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location
Location NameColumbia River estuary
CoordinatesLat. (o)46.235Long. (o)-123.91Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039637Metagenome / Metatranscriptome163N
F057377Metagenome / Metatranscriptome136N

Sequences

Protein IDFamilyRBSSequence
EsDRAFT_100934163F057377N/AMTTKPLAVFSTRDLKLATILLTLGFEPENPAAPATRIRRDSGDETTVFHFLANHPTSGQQANQVMEWFRDADIFLEKNPEHPVAYLIAALRNRDALVSVVKATPRQLVFERNGKIVSISENATEADKKRFAKFL*
EsDRAFT_100934164F039637N/AMKKQNDKSTANETLETDDEVLREQAMRDGTKRVGKFKLRPCVPGTISIIRSNLLEKRDEFWFVAAFAFVHTAPIEDILAVDSDPEEFNRAVRRWQLENIADLDDQNELSKLVSAAWDRVNAAETKAKNPSTGSPTSGE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.