Scaffold EsDRAFT_10056213

Overview

Basic Information

• Taxon OID: 3300000883
• Scaffold ID: EsDRAFT_10056213
• Source Dataset Name: Estuary microbial communities from the Columbia River - 5 PSU
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Maryland
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 944
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location

• Location Name: Columbia River estuary
• Coordinates
  • Lat. (^o): 46.235
  • Long. (^o): -123.91
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036355	Metagenome / Metatranscriptome	170	Y

Sequences

Protein ID	Family	RBS	Sequence
EsDRAFT_100562132	F036355	AGG	MRPLGTIDQIKPGSRIVYNDGRPGHSGIFANVLSVDPKGMTVQFEDRADMTRIAFSDRAWMXXXXXXXXX*