| Basic Information | |
|---|---|
| Taxon OID | 3300000882 Open in IMG/M |
| Scaffold ID | FwDRAFT_10162364 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from the Columbia River |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Maryland |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 601 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Columbia River freshwater tidal region | |||||||
| Coordinates | Lat. (o) | 46.18 | Long. (o) | -123.18 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F081249 | Metagenome | 114 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FwDRAFT_101623642 | F081249 | N/A | MKFKFFNSRGKFSPTLLLGKVMWRCTNGHPNYETEYSISCFGYKHMNKEKVYPIPSLYILRWHQGVLSSIESLGRSSGSVSIGIEWWNFQCSIMFLKVKHTKTTEQINECLNENLVL* |
| ⦗Top⦘ |