| Basic Information | |
|---|---|
| Taxon OID | 3300000882 Open in IMG/M |
| Scaffold ID | FwDRAFT_10080439 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from the Columbia River |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Maryland |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3856 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Columbia River freshwater tidal region | |||||||
| Coordinates | Lat. (o) | 46.18 | Long. (o) | -123.18 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053292 | Metagenome | 141 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| FwDRAFT_100804391 | F053292 | GAG | MSLNQILANSESVGINDHRFIGQMLSRNQRISTSEVVTVVPFSFDMQPMKYLLYSQNRALLNSLRIPDMALLQYLNFGSTGWTNYIAYQG |
| ⦗Top⦘ |